Web Analysis for Septictankemptyinghoniton - septictankemptyinghoniton.com
Contact the expert drainage engineers at All Clear, Honiton, for a smooth running sewage system. Call us today with your requirement.
2.88
Rating by CuteStat
septictankemptyinghoniton.com is 5 years 9 months old. It is a domain having com extension. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, septictankemptyinghoniton.com is SAFE to browse.
PageSpeed Score
73
Siteadvisor Rating
Not Applicable
Traffic Report
Daily Unique Visitors: | Not Applicable |
Daily Pageviews: | Not Applicable |
Estimated Valuation
Income Per Day: | $ 0.15 |
Estimated Worth: | $ 8.95 |
Search Engine Indexes
Google Indexed Pages: | Not Applicable |
Bing Indexed Pages: | Not Applicable |
Search Engine Backlinks
Google Backlinks: | Not Applicable |
Bing Backlinks: | Not Applicable |
Safety Information
Google Safe Browsing: | No Risk Issues |
Siteadvisor Rating: | Not Applicable |
WOT Trustworthiness: | Not Applicable |
WOT Child Safety: | Not Applicable |
Website Ranks & Scores
Alexa Rank: | Not Applicable |
Domain Authority: | Not Applicable |
Web Server Information
Page Resources Breakdown
Homepage Links Analysis
Website Inpage Analysis
H1 Headings: | 1 | H2 Headings: | 4 |
H3 Headings: | 7 | H4 Headings: | Not Applicable |
H5 Headings: | Not Applicable | H6 Headings: | Not Applicable |
Total IFRAMEs: | Not Applicable | Total Images: | 12 |
Google Adsense: | Not Applicable | Google Analytics: | UA-7265702-9 |
Websites Hosted on Same IP (i.e. 88.208.252.9)
Football Bet Data and Odds | Historical Football Results | Create a Be
- football-bet-data.co.uk
Not Applicable
$
8.95
Football Ramble Daily | Stakhanov
- thefootballramble.com
Football Ramble Daily is a must-listen for any discerning fan that enjoys the more entertaining side of the world’s favourite sport - broadcasting six days a week during the football season!
Not Applicable
$
8.95
Home - Simon Coulson
- simon-coulson.com
Simon Coulson climbed the corporate ladder with BT PLC for 14 years before quitting the city life. He started a series of internet businesses.
Not Applicable
$
8.95
HTTP Header Analysis
HTTP/1.1 200
Server: nginx/1.12.1
Date: Thu, 19 Jul 2018 19:15:50 GMT
Content-Type: text/html;charset=utf-8
Content-Length: 23594
Connection: keep-alive
Cache-Control: no-cache, no-store, must-revalidate
Content-Encoding: gzip
Expires: Thu, 01 Jan 1970 00:00:00 GMT
Pragma: no-cache
Vary: User-Agent,Accept-Encoding
Server: nginx/1.12.1
Date: Thu, 19 Jul 2018 19:15:50 GMT
Content-Type: text/html;charset=utf-8
Content-Length: 23594
Connection: keep-alive
Cache-Control: no-cache, no-store, must-revalidate
Content-Encoding: gzip
Expires: Thu, 01 Jan 1970 00:00:00 GMT
Pragma: no-cache
Vary: User-Agent,Accept-Encoding
Domain Information
Domain Nameserver Information
Host | IP Address | Country | |
---|---|---|---|
ns1.livedns.co.uk | 217.160.81.244 | Germany | |
ns2.livedns.co.uk | 217.160.82.244 | Germany | |
ns3.livedns.co.uk | 185.132.35.244 | Germany |
DNS Record Analysis
Host | Type | TTL | Extra |
---|---|---|---|
septictankemptyinghoniton.com | A | 3592 |
IP: 88.208.252.9 |
septictankemptyinghoniton.com | NS | 3600 |
Target: ns1.livedns.co.uk |
septictankemptyinghoniton.com | NS | 3600 |
Target: ns2.livedns.co.uk |
septictankemptyinghoniton.com | NS | 3600 |
Target: ns3.livedns.co.uk |
septictankemptyinghoniton.com | SOA | 3600 |
MNAME: ns1.livedns.co.uk RNAME: admin.septictankemptyinghoniton.com Serial: 1531918075 Refresh: 10800 Retry: 3600 Expire: 604800 Minimum TTL: 3600 |
septictankemptyinghoniton.com | MX | 3600 |
Priority: 10 Target: mailserver.septictankemptyinghoniton.com |
Full WHOIS Lookup
Domain Name: SEPTICTANKEMPTYINGHONITON.COM
Registry Domain ID: 2287003140_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.tucows.com
Registrar URL: http://www.tucowsdomains.com
Updated Date: 2018-07-18T12:40:12Z
Creation Date: 2018-07-18T12:40:12Z
Registry Expiry Date: 2020-07-18T12:40:12Z
Registrar: Tucows Domains Inc.
Registrar IANA ID: 69
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Name Server: NS1.LIVEDNS.CO.UK
Name Server: NS2.LIVEDNS.CO.UK
Name Server: NS3.LIVEDNS.CO.UK
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2018-07-19T19:15:48Z
Registry Domain ID: 2287003140_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.tucows.com
Registrar URL: http://www.tucowsdomains.com
Updated Date: 2018-07-18T12:40:12Z
Creation Date: 2018-07-18T12:40:12Z
Registry Expiry Date: 2020-07-18T12:40:12Z
Registrar: Tucows Domains Inc.
Registrar IANA ID: 69
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Name Server: NS1.LIVEDNS.CO.UK
Name Server: NS2.LIVEDNS.CO.UK
Name Server: NS3.LIVEDNS.CO.UK
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2018-07-19T19:15:48Z